SCOPe 2.08: Domain d2xxea2: 2xxe A:165-331

Lineage for d2xxea2 (2xxe A:165-331)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.0: automated matches [227146] (1 protein)
   not a true family

6. Protein automated matches [226850] (47 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [311258] (1 PDB entry)

8. Domain d2xxea2: 2xxe A:165-331 [304673]
   Other proteins in same PDB: d2xxea1, d2xxeb1, d2xxec1, d2xxed1
   automated match to d2v7pa2
   mutant

Details for d2xxea2

PDB Entry: 2xxe, 3 Å

PDB Description: single point mutant of Thermus thermophilus lactate dehydrogenase

PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2xxea2:

Sequence; same for both SEQRES and ATOM records:

>d2xxea2 d.162.1.0 (A:165-331) automated matches {Thermus thermophilus [TaxId: 300852]}
tildtarfrallaeylrvapqsvhayvlgehgdsevlvwssaqvggvpllefaeargaal
spedraridegvrraayriiegkgatyygigaglarlvrailtdekgvytvsaftpeveg
vlevslslprilgaggvegtvypslspeerealrrsaeilkeaafalgf

Timeline for d2xxea2:

• d2xxea2 first appeared in SCOPe 2.06
  
• d2xxea2 appears in SCOPe 2.07