Lineage for d2xaib_ (2xai B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2945442Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2945443Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2945444Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 2945540Protein Elongin C [54699] (3 species)
  7. 2945543Species Human (Homo sapiens) [TaxId:9606] [54700] (56 PDB entries)
  8. 2945604Domain d2xaib_: 2xai B: [304631]
    Other proteins in same PDB: d2xaif_
    automated match to d1lm8c_
    complexed with cl, edo, peg

Details for d2xaib_

PDB Entry: 2xai (more details), 2.58 Å

PDB Description: Crystal structure of ankyrin repeat and SOCS box-containing protein 9 (ASB9) in complex with elonginB and elonginC
PDB Compounds: (B:) Transcription elongation factor B polypeptide 1

SCOPe Domain Sequences for d2xaib_:

Sequence, based on SEQRES records: (download)

>d2xaib_ d.42.1.1 (B:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
yvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmyf
tykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records): (download)

>d2xaib_ d.42.1.1 (B:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
yvklissdghefivkrehaltsgtikamlnevnfreipshvlskvcmyftykvrytnsei
pefpiapeialellmaanfldc

SCOPe Domain Coordinates for d2xaib_:

Click to download the PDB-style file with coordinates for d2xaib_.
(The format of our PDB-style files is described here.)

Timeline for d2xaib_: