SCOPe 2.08: Domain d2x1yb1: 2x1y B:4-221

Lineage for d2x1yb1 (2x1y B:4-221)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily)
   multihelical consists of two all-alpha subdomains
   subdomain 1 (residues 10-100) is a 4-helical bundle

4. Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family)

5. Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein)

6. Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (2 species)

7. Species Escherichia coli [TaxId:562] [48171] (10 PDB entries)
   Uniprot Q08698

8. Domain d2x1yb1: 2x1y B:4-221 [304625]
   Other proteins in same PDB: d2x1ya2, d2x1yb2, d2x1yc2
   automated match to d2r1ra1

Details for d2x1yb1

PDB Entry: 2x1y, 2.1 Å

PDB Description: ribonucleotide reductase y731no2y modified r1 subunit of e. coli to 2.1 a resolution

PDB Compounds: (B:) ribonucleoside-diphosphate reductase 1 subunit alpha

SCOPe Domain Sequences for d2x1yb1:

Sequence; same for both SEQRES and ATOM records:

>d2x1yb1 a.98.1.1 (B:4-221) R1 subunit of ribonucleotide reductase, N-terminal domain {Escherichia coli [TaxId: 562]}
nllvtkrdgsterinldkihrvldwaaeglhnvsisqvelrshiqfydgiktsdihetii
kaaadlisrdapdyqylaarlaifhlrkkaygqfeppalydhvvkmvemgkydnhlledy
teeefkqmdtfidhdrdmtfsyaavkqlegkylvqnrvtgeiyesaqflyilvaaclfsn
ypretrlqyvkrfydavstfkislptpimsgvrtptrq

Timeline for d2x1yb1:

• d2x1yb1 first appeared in SCOPe 2.06
  
• d2x1yb1 appears in SCOPe 2.07