SCOPe 2.07: Domain d2wmfa2: 2wmf A:426-589

Lineage for d2wmfa2 (2wmf A:426-589)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (2 superfamilies)
   sandwich, 10 strands in 2 sheets; "folded meander"

4. Superfamily b.24.2: Glycosyl hydrolase family 98 C-terminal domain-like [310597] (2 families)
   C-terminal half of Pfam PF08307
   Slightly different topology from Hyaluronate lyase; contains helical insert

5. Family b.24.2.1: Glycosyl hydrolase family 98 C-terminal domain [310645] (1 protein)

6. Protein Sp4GH98 [310791] (1 species)

7. Species Streptococcus pneumoniae TIGR4 [TaxId:170187] [311049] (1 PDB entry)

8. Domain d2wmfa2: 2wmf A:426-589 [304586]
   Other proteins in same PDB: d2wmfa1

Details for d2wmfa2

PDB Entry: 2wmf, 1.5 Å

PDB Description: crystal structure of the catalytic module of a family 98 glycoside hydrolase from streptococcus pneumoniae tigr4 (sp4gh98) in its native form.

PDB Compounds: (A:) fucolectin-related protein

SCOPe Domain Sequences for d2wmfa2:

Sequence; same for both SEQRES and ATOM records:

>d2wmfa2 b.24.2.1 (A:426-589) Sp4GH98 {Streptococcus pneumoniae TIGR4 [TaxId: 170187]}
yegdgyaqrvgnswyiynsnaninknqqvmlpmytnntkslsldltphtyavvkenpnnl
hillnnyrtdktamwalsgnfdaskswkkeelelanwisknysinpvdndfrtttltlsg
htghkpqinisgdknhytytenwdenthvytitvnhngmvemsi

Timeline for d2wmfa2:

• d2wmfa2 first appeared in SCOPe 2.06
  
• d2wmfa2 appears in the current release, SCOPe 2.08