Lineage for d2wmfa2 (2wmf A:426-589)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387466Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (2 superfamilies)
    sandwich, 10 strands in 2 sheets; "folded meander"
  4. 2387523Superfamily b.24.2: Glycosyl hydrolase family 98 C-terminal domain-like [310597] (2 families) (S)
    C-terminal half of Pfam PF08307
    Slightly different topology from Hyaluronate lyase; contains helical insert
  5. 2387524Family b.24.2.1: Glycosyl hydrolase family 98 C-terminal domain [310645] (1 protein)
  6. 2387525Protein Sp4GH98 [310791] (1 species)
  7. 2387526Species Streptococcus pneumoniae TIGR4 [TaxId:170187] [311049] (1 PDB entry)
  8. 2387527Domain d2wmfa2: 2wmf A:426-589 [304586]
    Other proteins in same PDB: d2wmfa1

Details for d2wmfa2

PDB Entry: 2wmf (more details), 1.5 Å

PDB Description: crystal structure of the catalytic module of a family 98 glycoside hydrolase from streptococcus pneumoniae tigr4 (sp4gh98) in its native form.
PDB Compounds: (A:) fucolectin-related protein

SCOPe Domain Sequences for d2wmfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wmfa2 b.24.2.1 (A:426-589) Sp4GH98 {Streptococcus pneumoniae TIGR4 [TaxId: 170187]}
yegdgyaqrvgnswyiynsnaninknqqvmlpmytnntkslsldltphtyavvkenpnnl
hillnnyrtdktamwalsgnfdaskswkkeelelanwisknysinpvdndfrtttltlsg
htghkpqinisgdknhytytenwdenthvytitvnhngmvemsi

SCOPe Domain Coordinates for d2wmfa2:

Click to download the PDB-style file with coordinates for d2wmfa2.
(The format of our PDB-style files is described here.)

Timeline for d2wmfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2wmfa1