SCOPe 2.08: Domain d2wmfa1: 2wmf A:35-425

Lineage for d2wmfa1 (2wmf A:35-425)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology
   missing some secondary structures that made up less than one-third of the common domain
   

6. Protein P-glycoprotein (P-gp) multidrug resistance protein, head domain [310790] (2 species)
   Pfam PF09818

7. Species Streptococcus pneumoniae TIGR4 [TaxId:170187] [311048] (1 PDB entry)

8. Domain d2wmfa1: 2wmf A:35-425 [304585]
   Other proteins in same PDB: d2wmfa2
   has additional insertions and/or extensions that are not grouped together

Details for d2wmfa1

PDB Entry: 2wmf, 1.5 Å

PDB Description: crystal structure of the catalytic module of a family 98 glycoside hydrolase from streptococcus pneumoniae tigr4 (sp4gh98) in its native form.

PDB Compounds: (A:) fucolectin-related protein

SCOPe Domain Sequences for d2wmfa1:

Sequence; same for both SEQRES and ATOM records:

>d2wmfa1 c.37.1.12 (A:35-425) P-glycoprotein (P-gp) multidrug resistance protein, head domain {Streptococcus pneumoniae TIGR4 [TaxId: 170187]}
vqmrttinnesplllsplygndngnglwwgntlkgaweaipedvkpyaaielhpakvckp
tsciprdtkelrewyvkmleeaqslnipvflvimsagerntvppewldeqfqkysvlkgv
lnienywiynnqlaphsakylevcakygahfiwhdhekwfwetimndptffeasqkyhkn
lvlatkntpirddagtdsivsgfwlsglcdnwgsstdtwkwwekhytntfetgrardmrs
yasepesmiamemmnvytgggtvynfecaaytfmtndvptpaftkgiipffrhaiqnpap
skeevvnrtkavfwngegrisslngfyqglysndetmplynngryhilpvihekidkeki
ssifpnakiltknseelsskvnylnslypkl

Timeline for d2wmfa1:

• d2wmfa1 first appeared in SCOPe 2.06
  
• d2wmfa1 appears in SCOPe 2.07