Class a: All alpha proteins [46456] (289 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
Protein automated matches [190113] (17 species) not a true protein |
Species Crithidia fasciculata [TaxId:5656] [189994] (2 PDB entries) |
Domain d2w9ka_: 2w9k A: [304568] automated match to d2yk3a_ complexed with hec, so4 |
PDB Entry: 2w9k (more details), 1.55 Å
SCOPe Domain Sequences for d2w9ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w9ka_ a.3.1.1 (A:) automated matches {Crithidia fasciculata [TaxId: 5656]} araplppgdaargeklfkgraaqchtanqggangvgpnlyglvgrhsgtiegyayskana esgvvwtpdvldvylenpkkfmpgtkmsfagmkkpqeradviayletlkg
Timeline for d2w9ka_: