SCOPe 2.06: Domain d2vjgb_: 2vjg B:

Lineage for d2vjgb_ (2vjg B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (22 species)
   not a true protein

7. Species Carrot (Daucus carota) [TaxId:4039] [311246] (1 PDB entry)

8. Domain d2vjgb_: 2vjg B: [304548]
   automated match to d3ie5a_
   complexed with edo, p4c, peg, pg4, pge

Details for d2vjgb_

PDB Entry: 2vjg, 2.7 Å

PDB Description: crystal structure of the major carrot allergen dau c 1

PDB Compounds: (B:) major allergen dau c 1

SCOPe Domain Sequences for d2vjgb_:

Sequence; same for both SEQRES and ATOM records:

>d2vjgb_ d.129.3.0 (B:) automated matches {Carrot (Daucus carota) [TaxId: 4039]}
aqshsleitssvsaekifsgivldvdtvipkaatgayksvevkgdggagtvriitlpegs
pittmtvrtdavnkealsydstvidgdillgfiesiethmvvvptadggsitkttaifht
kgdavvpeenikfadaqntalfkaieaylian

Timeline for d2vjgb_:

• d2vjgb_ is new in SCOPe 2.06-stable
  
• d2vjgb_ appears in SCOPe 2.07
  
• d2vjgb_ appears in the current release, SCOPe 2.08