Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) |
Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (9 proteins) |
Protein Glutathione reductase [51944] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [51945] (16 PDB entries) |
Domain d1xan_2: 1xan 166-290 [30450] Other proteins in same PDB: d1xan_3 |
PDB Entry: 1xan (more details), 2 Å
SCOP Domain Sequences for d1xan_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xan_2 c.3.1.5 (166-290) Glutathione reductase {Human (Homo sapiens)} sqipgaslgitsdgffqleelpgrsvivgagyiavemagilsalgsktslmirhdkvlrs fdsmistncteelenagvevlkfsqvkevkktlsglevsmvtavpgrlpvmtmipdvdcl lwaig
Timeline for d1xan_2: