Lineage for d1xan_2 (1xan 166-290)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 20781Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 20782Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 20948Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (9 proteins)
  6. 20992Protein Glutathione reductase [51944] (2 species)
  7. 21010Species Human (Homo sapiens) [TaxId:9606] [51945] (16 PDB entries)
  8. 21020Domain d1xan_2: 1xan 166-290 [30450]
    Other proteins in same PDB: d1xan_3

Details for d1xan_2

PDB Entry: 1xan (more details), 2 Å

PDB Description: human glutathione reductase in complex with a xanthene inhibitor

SCOP Domain Sequences for d1xan_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xan_2 c.3.1.5 (166-290) Glutathione reductase {Human (Homo sapiens)}
sqipgaslgitsdgffqleelpgrsvivgagyiavemagilsalgsktslmirhdkvlrs
fdsmistncteelenagvevlkfsqvkevkktlsglevsmvtavpgrlpvmtmipdvdcl
lwaig

SCOP Domain Coordinates for d1xan_2:

Click to download the PDB-style file with coordinates for d1xan_2.
(The format of our PDB-style files is described here.)

Timeline for d1xan_2: