SCOPe 2.06: Domain d2rsga_: 2rsg A:

Lineage for d2rsga_ (2rsg A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186914] (54 PDB entries)

8. Domain d2rsga_: 2rsg A: [304475]
   automated match to d4hhvb_

Details for d2rsga_

PDB Entry: 2rsg

PDB Description: Solution structure of the CERT PH domain

PDB Compounds: (A:) Collagen type IV alpha-3-binding protein

SCOPe Domain Sequences for d2rsga_:

Sequence; same for both SEQRES and ATOM records:

>d2rsga_ b.55.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vercgvlskwtnyihgwqdrwvvlknnalsyyksedeteygcrgsiclskavitphdfde
crfdisvndsvwylraqdpdhrqqwidaieqhkt

Timeline for d2rsga_:

• d2rsga_ is new in SCOPe 2.06-stable
  
• d2rsga_ appears in SCOPe 2.07
  
• d2rsga_ appears in the current release, SCOPe 2.08