SCOPe 2.06: Domain d2rkwb1: 2rkw B:10-75

Lineage for d2rkwb1 (2rkw B:10-75)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families)
   automatically mapped to Pfam PF02874

5. Family b.49.1.0: automated matches [254232] (1 protein)
   not a true family

6. Protein automated matches [254527] (11 species)
   not a true protein

7. Species Methanosarcina mazei [TaxId:2209] [311241] (3 PDB entries)

8. Domain d2rkwb1: 2rkw B:10-75 [304465]
   Other proteins in same PDB: d2rkwa1, d2rkwa2, d2rkwb2, d2rkwb3
   automated match to d3j9tb1
   mutant

Details for d2rkwb1

PDB Entry: 2rkw, 2.81 Å

PDB Description: intermediate position of atp on its trail to the binding pocket inside the subunit b mutant r416w of the energy converter a1ao atp synthase

PDB Compounds: (B:) V-type ATP synthase beta chain

SCOPe Domain Sequences for d2rkwb1:

Sequence, based on SEQRES records:

>d2rkwb1 b.49.1.0 (B:10-75) automated matches {Methanosarcina mazei [TaxId: 2209]}
qiagplifvektepvgyneivnikmgdgtvrrgqvldssadivvvqvfegtggldkdcgv
iftget

Sequence, based on observed residues (ATOM records):

>d2rkwb1 b.49.1.0 (B:10-75) automated matches {Methanosarcina mazei [TaxId: 2209]}
qiagplifvektepvgyneivnikmgdgtvrrgqvldssadivvvqvfeftget

Timeline for d2rkwb1:

• d2rkwb1 is new in SCOPe 2.06-stable
  
• d2rkwb1 appears in SCOPe 2.07
  
• d2rkwb1 appears in the current release, SCOPe 2.08