Lineage for d2qkza_ (2qkz A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262912Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2263118Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 2263119Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 2263128Protein Rubredoxin [57804] (8 species)
  7. 2263166Species Desulfovibrio vulgaris [TaxId:881] [57805] (8 PDB entries)
  8. 2263176Domain d2qkza_: 2qkz A: [304421]
    automated match to d1rb9a_
    complexed with ni

Details for d2qkza_

PDB Entry: 2qkz (more details)

PDB Description: Nickel-substituted Rubredoxin from Desulfovibrio Vulgaris
PDB Compounds: (A:) rubredoxin

SCOPe Domain Sequences for d2qkza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qkza_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio vulgaris [TaxId: 881]}
mkkyvctvcgyeydpaegdpdngvkpgtsfddlpadwvcpvcgapksefeaa

SCOPe Domain Coordinates for d2qkza_:

Click to download the PDB-style file with coordinates for d2qkza_.
(The format of our PDB-style files is described here.)

Timeline for d2qkza_: