Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins) contains a conserved all-alpha subdomain at the C-terminal extension |
Protein Tyrosyl-tRNA synthetase (TyrRS) [52376] (6 species) |
Species Methanococcus jannaschii [TaxId:2190] [89611] (9 PDB entries) |
Domain d2q1ia1: 2q1i A:2-306 [304395] Other proteins in same PDB: d2q1ia2 automated match to d4nd7a_ complexed with bme, tfq |
PDB Entry: 2q1i (more details), 2.2 Å
SCOPe Domain Sequences for d2q1ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q1ia1 c.26.1.1 (A:2-306) Tyrosyl-tRNA synthetase (TyrRS) {Methanococcus jannaschii [TaxId: 2190]} defemikrntseiiseeelrevlkkdeksaiigfepsgkihlghylqikkmidlqnagfd iiilladlfaylnqkgeldeirkigdynkkvfeamglkakyvygssfqldkdytlnvyrl alkttlkrarrsmeliaredenpkvaeviypimqvnplhyegvdvavggmeqrkihmlar ellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnpi meiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikilep irkrl
Timeline for d2q1ia1: