Lineage for d2pmml1 (2pmm L:49-86)
- Root: SCOPe 2.07
Class g: Small proteins [56992] (98 folds) 
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
Superfamily g.3.11: EGF/Laminin [57196] (8 families) 
Family g.3.11.1: EGF-type module [57197] (23 proteins) 
Protein Coagulation factor VIIa [57201] (1 species) Species Human (Homo sapiens) [TaxId:9606] [57202] (97 PDB entries)
Uniprot P08709 108-202 ! Uniprot P08709 107-202
Domain d2pmml1: 2pmm L:49-86 [304355]
automated match to d4ylql2
complexed with ca, ch2, fuc, glc
Details for d2pmml1
PDB Entry: 2pmm (more details), 2.05 Å
PDB Description: Crystal structure of active site inhibited coagulation factor VIIA in complex with soluble tissue factor
PDB Compounds: (L:) Coagulation factor VIISCOPe Domain Sequences for d2pmml1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pmml1 g.3.11.1 (L:49-86) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
qcasspcqnggsckdqlqsyicfclpafegrncethkd
SCOPe Domain Coordinates for d2pmml1:
Click to download the PDB-style file with coordinates for d2pmml1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2pmml1:
View in 3D
