Lineage for d1qo8d2 (1qo8 D:103-359,D:506-565)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 20781Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 20782Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 20922Family c.3.1.4: Succinate dehydrogenase/fumarate reductase N-terminal domain [51934] (3 proteins)
  6. 20923Protein Flavocytochrome c3 (respiratory fumarate reductase) [51940] (2 species)
  7. 20924Species Shewanella frigidimarina [TaxId:56812] [51941] (3 PDB entries)
  8. 20928Domain d1qo8d2: 1qo8 D:103-359,D:506-565 [30434]
    Other proteins in same PDB: d1qo8a1, d1qo8a3, d1qo8d1, d1qo8d3

Details for d1qo8d2

PDB Entry: 1qo8 (more details), 2.15 Å

PDB Description: the structure of the open conformation of a flavocytochrome c3 fumarate reductase

SCOP Domain Sequences for d1qo8d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qo8d2 c.3.1.4 (D:103-359,D:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina}
dgwdqdkiqkaiaagpsettqvlvvgagsagfnaslaakkaganvilvdkapfsggnsmi
saggmnavgtkqqtahgvedkvewfiedamkggrqqndiklvtilaeqsadgvqwleslg
anlddlkrsggarvdrthrphggkssgpeiidtlrkaakeqgidtrlnsrvvklvvnddh
svvgavvhgkhtgyymigaksvvlatggygmnkemiayyrptmkdmtssnnitatgdgvl
makeigasmtdidwvqaXainttasvldlqskpidglfaagevtggvhgynrlggnaiad
tvvfgriagdnaakhald

SCOP Domain Coordinates for d1qo8d2:

Click to download the PDB-style file with coordinates for d1qo8d2.
(The format of our PDB-style files is described here.)

Timeline for d1qo8d2: