Lineage for d1qo8a2 (1qo8 A:103-359,A:506-565)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849779Family c.3.1.4: Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain [51934] (5 proteins)
  6. 2849786Protein Flavocytochrome c3 (respiratory fumarate reductase) [51940] (2 species)
    contains additional N-terminal multiheme domain
  7. 2849787Species Shewanella frigidimarina [TaxId:56812] [51941] (16 PDB entries)
  8. 2849809Domain d1qo8a2: 1qo8 A:103-359,A:506-565 [30433]
    Other proteins in same PDB: d1qo8a1, d1qo8a3, d1qo8d1, d1qo8d3
    complexed with fad, hem

Details for d1qo8a2

PDB Entry: 1qo8 (more details), 2.15 Å

PDB Description: the structure of the open conformation of a flavocytochrome c3 fumarate reductase
PDB Compounds: (A:) flavocytochrome c3 fumarate reductase

SCOPe Domain Sequences for d1qo8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]}
dgwdqdkiqkaiaagpsettqvlvvgagsagfnaslaakkaganvilvdkapfsggnsmi
saggmnavgtkqqtahgvedkvewfiedamkggrqqndiklvtilaeqsadgvqwleslg
anlddlkrsggarvdrthrphggkssgpeiidtlrkaakeqgidtrlnsrvvklvvnddh
svvgavvhgkhtgyymigaksvvlatggygmnkemiayyrptmkdmtssnnitatgdgvl
makeigasmtdidwvqaXainttasvldlqskpidglfaagevtggvhgynrlggnaiad
tvvfgriagdnaakhald

SCOPe Domain Coordinates for d1qo8a2:

Click to download the PDB-style file with coordinates for d1qo8a2.
(The format of our PDB-style files is described here.)

Timeline for d1qo8a2: