SCOPe 2.06: Domain d2oy6b_: 2oy6 B:

Lineage for d2oy6b_ (2oy6 B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (30 species)
   not a true protein

7. Species Todarodes pacificus [TaxId:6637] [189005] (4 PDB entries)

8. Domain d2oy6b_: 2oy6 B: [304310]
   automated match to d3i5gb_
   complexed with adp, mg

Details for d2oy6b_

PDB Entry: 2oy6, 3 Å

PDB Description: Crystal structure of Squid Mg.ADP myosin S1

PDB Compounds: (B:) Myosin regulatory light chain LC-2

SCOPe Domain Sequences for d2oy6b_:

Sequence; same for both SEQRES and ATOM records:

>d2oy6b_ a.39.1.0 (B:) automated matches {Todarodes pacificus [TaxId: 6637]}
rvklsqrqmqelkeaftmidqdrdgfigmedlkdmfsslgrvppddelnamlkecpgqln
ftafltlfgekvsgtdpedalrnafsmfdedgqgfipedylkdllenmgdnfskeeiknv
wkdaplknkqfnynkmvdikgkaed

Timeline for d2oy6b_:

• d2oy6b_ is new in SCOPe 2.06-stable
  
• d2oy6b_ appears in SCOPe 2.07
  
• d2oy6b_ appears in the current release, SCOPe 2.08