SCOPe 2.06: Domain d2ot6a_: 2ot6 A:

Lineage for d2ot6a_ (2ot6 A:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (2 families)

5. Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins)

6. Protein automated matches [192457] (4 species)
   not a true protein

7. Species Vigna sinensis [311235] (1 PDB entry)

8. Domain d2ot6a_: 2ot6 A: [304305]
   automated match to d1bbia_

Details for d2ot6a_

PDB Entry: 2ot6, 2.5 Å

PDB Description: Crystal Structure of a Bowman-Birk Inhibitor from Vigna Unguiculata Seeds

PDB Compounds: (A:) trypsin inhibitor

SCOPe Domain Sequences for d2ot6a_:

Sequence, based on SEQRES records:

>d2ot6a_ g.3.13.1 (A:) automated matches {Vigna sinensis}
pccdscvctksippqchctnirlnschsgcksclctasapgscrcldianfcykpck

Sequence, based on observed residues (ATOM records):

>d2ot6a_ g.3.13.1 (A:) automated matches {Vigna sinensis}
pccdscvctksippqchctnirlnschsgcksclctasgscrcldianfcykpck

Timeline for d2ot6a_:

• d2ot6a_ is new in SCOPe 2.06-stable
  
• d2ot6a_ appears in SCOPe 2.07
  
• d2ot6a_ appears in the current release, SCOPe 2.08