Class g: Small proteins [56992] (100 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (2 families) |
Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins) |
Protein automated matches [192457] (4 species) not a true protein |
Species Vigna sinensis [311235] (1 PDB entry) |
Domain d2ot6a_: 2ot6 A: [304305] automated match to d1bbia_ |
PDB Entry: 2ot6 (more details), 2.5 Å
SCOPe Domain Sequences for d2ot6a_:
Sequence, based on SEQRES records: (download)
>d2ot6a_ g.3.13.1 (A:) automated matches {Vigna sinensis} pccdscvctksippqchctnirlnschsgcksclctasapgscrcldianfcykpck
>d2ot6a_ g.3.13.1 (A:) automated matches {Vigna sinensis} pccdscvctksippqchctnirlnschsgcksclctasgscrcldianfcykpck
Timeline for d2ot6a_: