Lineage for d2ospf_ (2osp F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813016Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
    single sheet formed by beta-hairpin repeats; exposed on both sides in the middle
  4. 2813017Superfamily b.76.1: Outer surface protein [51087] (1 family) (S)
    21 stranded sheet partly folded upon itself at the ends
  5. 2813018Family b.76.1.1: Outer surface protein [51088] (3 proteins)
  6. 2813019Protein Outer surface protein A [51089] (1 species)
  7. 2813020Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [51090] (3 PDB entries)
  8. 2813023Domain d2ospf_: 2osp F: [304304]
    Other proteins in same PDB: d2ospa1, d2ospa2, d2ospc1, d2ospc2
    automated match to d1ospo_

Details for d2ospf_

PDB Entry: 2osp (more details), 2.68 Å

PDB Description: lyme disease antigen ospa in complex with neutralizing antibody fab la-2
PDB Compounds: (F:) protein (outer surface protein a)

SCOPe Domain Sequences for d2ospf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ospf_ b.76.1.1 (F:) Outer surface protein A {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
sldeknsvsvdlpgemkvlvskeknkdgkydliatvdklelkgtsdknngsgvlegvkad
kckvkltisddlgqttlevfkedgktlvskkvtskdkssteekfnekgevsekiitradg
trleytgiksdgsgkakevlkgyvlegtltaekttlvvkegtvtlsknisksgevsveln
dtdssaatkktaawnsgtstltitvnskktkdlvftkentitvqqydsngtklegsavei
tkldeiknalk

SCOPe Domain Coordinates for d2ospf_:

Click to download the PDB-style file with coordinates for d2ospf_.
(The format of our PDB-style files is described here.)

Timeline for d2ospf_: