Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries) |
Domain d2ospc2: 2osp C:108-214 [304302] Other proteins in same PDB: d2ospa1, d2ospc1, d2ospe_, d2ospf_ automated match to d1eapa2 |
PDB Entry: 2osp (more details), 2.68 Å
SCOPe Domain Sequences for d2ospc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ospc2 b.1.1.0 (C:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvdwkidgserqngvlnswtdqd skdstysmsstltlskadyerhnsyaceathktstspvvksfnrnex
Timeline for d2ospc2:
View in 3D Domains from other chains: (mouse over for more information) d2ospa1, d2ospa2, d2ospe_, d2ospf_ |