Lineage for d2ospc2 (2osp C:108-214)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369776Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
  8. 2370454Domain d2ospc2: 2osp C:108-214 [304302]
    Other proteins in same PDB: d2ospa1, d2ospc1, d2ospe_, d2ospf_
    automated match to d1eapa2

Details for d2ospc2

PDB Entry: 2osp (more details), 2.68 Å

PDB Description: lyme disease antigen ospa in complex with neutralizing antibody fab la-2
PDB Compounds: (C:) protein (hybridoma antibody la2 (light chain))

SCOPe Domain Sequences for d2ospc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ospc2 b.1.1.0 (C:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvdwkidgserqngvlnswtdqd
skdstysmsstltlskadyerhnsyaceathktstspvvksfnrnex

SCOPe Domain Coordinates for d2ospc2:

Click to download the PDB-style file with coordinates for d2ospc2.
(The format of our PDB-style files is described here.)

Timeline for d2ospc2: