SCOPe 2.06: Domain d2ospa2: 2osp A:108-214

Lineage for d2ospa2 (2osp A:108-214)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)

8. Domain d2ospa2: 2osp A:108-214 [304300]
   Other proteins in same PDB: d2ospa1, d2ospc1, d2ospe_, d2ospf_
   automated match to d1eapa2

Details for d2ospa2

PDB Entry: 2osp, 2.68 Å

PDB Description: lyme disease antigen ospa in complex with neutralizing antibody fab la-2

PDB Compounds: (A:) protein (hybridoma antibody la2 (light chain))

SCOPe Domain Sequences for d2ospa2:

Sequence; same for both SEQRES and ATOM records:

>d2ospa2 b.1.1.0 (A:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvdwkidgserqngvlnswtdqd
skdstysmsstltlskadyerhnsyaceathktstspvvksfnrnex

Timeline for d2ospa2:

• d2ospa2 is new in SCOPe 2.06-stable
  
• d2ospa2 appears in SCOPe 2.07
  
• d2ospa2 appears in the current release, SCOPe 2.08