Lineage for d1qlbd2 (1qlb D:1-250,D:372-457)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 176176Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 176177Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 176345Family c.3.1.4: Succinate dehydrogenase/fumarate reductase N-terminal domain [51934] (4 proteins)
  6. 176374Protein Fumarate reductase flavoprotein subunit [51937] (2 species)
  7. 176382Species Wolinella succinogenes [TaxId:844] [51939] (3 PDB entries)
  8. 176386Domain d1qlbd2: 1qlb D:1-250,D:372-457 [30430]
    Other proteins in same PDB: d1qlba1, d1qlba3, d1qlbb1, d1qlbb2, d1qlbc_, d1qlbd1, d1qlbd3, d1qlbe1, d1qlbe2, d1qlbf_

Details for d1qlbd2

PDB Entry: 1qlb (more details), 2.33 Å

PDB Description: respiratory complex II-like fumarate reductase from Wolinella succinogenes

SCOP Domain Sequences for d1qlbd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qlbd2 c.3.1.4 (D:1-250,D:372-457) Fumarate reductase flavoprotein subunit {Wolinella succinogenes}
mkvqycdslviggglaglraavatqqkglstivlslipvkrshsaaaqggmqaslgnskm
sdgdnedlhfmdtvkgsdwgcdqkvarmfvntapkairelaawgvpwtrihkgdrmaiin
aqkttiteedfrhglihsrdfggtkkwrtcytadatghtmlfavaneclklgvsiqdrke
aialihqdgkcygavvrdlvtgdiiayvakgtliatggygriyknttnavvcegtgtaia
letgiaqlgnXmggirtdyrgeaklkglfsageaacwdmhgfnrlggnsvseavvagmiv
geyfaehcantqvdletktlekfvkgqeaymkslves

SCOP Domain Coordinates for d1qlbd2:

Click to download the PDB-style file with coordinates for d1qlbd2.
(The format of our PDB-style files is described here.)

Timeline for d1qlbd2: