![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (22 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [186842] (202 PDB entries) |
![]() | Domain d2ospa1: 2osp A:1-107 [304299] Other proteins in same PDB: d2ospa2, d2ospc2, d2ospe_, d2ospf_ automated match to d1eapa1 |
PDB Entry: 2osp (more details), 2.68 Å
SCOPe Domain Sequences for d2ospa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ospa1 b.1.1.1 (A:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]} diqmtqspsslsatlggkvtitckasqdinkyiawyqhkpgkgprllihytstlqpgnps rfsgsgsgrdysfsisnleaediaiyyclqydnlqrtfgggtkveik
Timeline for d2ospa1:
![]() Domains from other chains: (mouse over for more information) d2ospc1, d2ospc2, d2ospe_, d2ospf_ |