Lineage for d1fumm2 (1fum M:1-225,M:358-442)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 119015Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 119016Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 119166Family c.3.1.4: Succinate dehydrogenase/fumarate reductase N-terminal domain [51934] (4 proteins)
  6. 119190Protein Fumarate reductase flavoprotein subunit [51937] (2 species)
  7. 119191Species Escherichia coli [TaxId:562] [51938] (1 PDB entry)
  8. 119193Domain d1fumm2: 1fum M:1-225,M:358-442 [30426]
    Other proteins in same PDB: d1fuma1, d1fuma3, d1fumb1, d1fumb2, d1fumc_, d1fumd_, d1fumm1, d1fumm3, d1fumn1, d1fumn2, d1fumo_, d1fump_

Details for d1fumm2

PDB Entry: 1fum (more details), 3.3 Å

PDB Description: structure of the e. coli fumarate reductase respiratory complex

SCOP Domain Sequences for d1fumm2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fumm2 c.3.1.4 (M:1-225,M:358-442) Fumarate reductase flavoprotein subunit {Escherichia coli}
qtfqadlaivgaggaglraaiaaaqanpnakialiskvypmrshtvaaeggsaavaqdhd
sfeyhfhdtvaggdwlceqdvvdyfvhhcptemtqlelwgcpwsrrpdgsvnvrrfggmk
iertwfaadktgfhmlhtlfqtslqfpqiqrfdehfvldilvddghvrglvamnmmegtl
vqiranavvmatggagrvyryntnggivtgdgmgmalshgvplrdXmggietdqncetri
kglfavgecssvglhganrlgsnslaelvvfgrlageqateraatagngneaaieaqaag
veqrlkdlvnq

SCOP Domain Coordinates for d1fumm2:

Click to download the PDB-style file with coordinates for d1fumm2.
(The format of our PDB-style files is described here.)

Timeline for d1fumm2: