SCOPe 2.08: Domain d2lxua1: 2lxu A:7-111

Lineage for d2lxua1 (2lxu A:7-111)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188315] (106 PDB entries)

8. Domain d2lxua1: 2lxu A:7-111 [304190]
   Other proteins in same PDB: d2lxua2
   automated match to d2kfya_

Details for d2lxua1

PDB Entry: 2lxu

PDB Description: Solution NMR Structure of the eukaryotic RNA recognition motif, RRM1, from the heterogeneous nuclear ribonucleoprotein H from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR8614A

PDB Compounds: (A:) Heterogeneous nuclear ribonucleoprotein H

SCOPe Domain Sequences for d2lxua1:

Sequence; same for both SEQRES and ATOM records:

>d2lxua1 d.58.7.0 (A:7-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggegfvvkvrglpwscsadevqrffsdckiqngaqgirfiytregrpsgeafvelesede
vklalkkdretmghryvevfksnnvemdwvlkhtgpnspdtandg

Timeline for d2lxua1:

• d2lxua1 first appeared in SCOPe 2.06
  
• d2lxua1 appears in SCOPe 2.07