SCOPe 2.08: Domain d2kcja1: 2kcj A:1-100

Lineage for d2kcja1 (2kcj A:1-100)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186914] (120 PDB entries)

8. Domain d2kcja1: 2kcj A:1-100 [304156]
   Other proteins in same PDB: d2kcja2
   automated match to d4hhvb_

Details for d2kcja1

PDB Entry: 2kcj

PDB Description: solution structure of fapp1 ph domain

PDB Compounds: (A:) Pleckstrin homology domain-containing family A member 3

SCOPe Domain Sequences for d2kcja1:

Sequence; same for both SEQRES and ATOM records:

>d2kcja1 b.55.1.0 (A:1-100) automated matches {Human (Homo sapiens) [TaxId: 9606]}
megvlykwtnyltgwqprwfvldngilsyydsqddvckgskgsikmavceikvhsadntr
meliipgeqhfymkavnaaerqrwlvalgsskasltdtrt

Timeline for d2kcja1:

• d2kcja1 first appeared in SCOPe 2.06
  
• d2kcja1 appears in SCOPe 2.07