Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily) duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis |
Superfamily d.126.1: Pentein [55909] (8 families) |
Family d.126.1.6: Porphyromonas-type peptidylarginine deiminase [111155] (3 proteins) Pfam PF04371; functionally related to the amidinotransferase, similar active site |
Protein automated matches [190353] (3 species) not a true protein |
Species Enterococcus faecalis [311217] (1 PDB entry) |
Domain d2j2th_: 2j2t H: [304101] Other proteins in same PDB: d2j2td2 automated match to d2jerd_ |
PDB Entry: 2j2t (more details), 1.65 Å
SCOPe Domain Sequences for d2j2th_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j2th_ d.126.1.6 (H:) automated matches {Enterococcus faecalis} akrivgstpkqdgfrmpgefepqekvwmiwperpdnwrdggkpvqeaftnvakaisqftp mnvvvsqqqfqncrrqlppeitvyemsnndawvrdcgpsfvindhgeirgvdwtfnawgg lvdglyfpwdqddlvaqkiceiehvdsyrtddfvleggsfhvdgqgtvlttemcllsegr npqlskeaieqklcdylnvekvlwlgdgidpeetnghvddvacfiapgevaciytedqns pfyeaaqdayqrllkmtdakgrqlkvhklccpvknvtikgsfkidfvegtmpredgdici asymnflitndgvivpqygdendhlaleqvqtmfpdkkivgvntvevvygggnihcitqq epkrv
Timeline for d2j2th_: