SCOPe 2.08: Domain d2ixxa_: 2ixx A:

Lineage for d2ixxa_ (2ixx A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.4.3: Porins [56935] (5 families)

5. Family f.4.3.1: Porin [56936] (2 proteins)
   trimer, one subunit folds into (16,20) barrel

6. Protein automated matches [190289] (7 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187889] (9 PDB entries)

8. Domain d2ixxa_: 2ixx A: [304085]
   automated match to d2xe1a_
   complexed with mha

Details for d2ixxa_

PDB Entry: 2ixx, 2.5 Å

PDB Description: structural basis for ompc mediated antibiotic resistance in clinical isolates of escherichia coli.

PDB Compounds: (A:) Outer membrane protein C

SCOPe Domain Sequences for d2ixxa_:

Sequence; same for both SEQRES and ATOM records:

>d2ixxa_ f.4.3.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
aevynkdgnkldlygkvdglhyfsddksvdgdqtymrlgfkgetqvtdqltgygqweyqi
qgnapesennswtrvafaglkfqdigsfdygrnygvvydvtswtdvlpefggdtygsdnf
mqqrgngfatyrntdffglvdglnfavqyqgqngsvsgendpdftghgitnngrkalrqn
gdgvggsitydyegfgvgaavssskrtwdqnntgligtgdraetytgglkydanniylaa
qytqtynatrvgslgwankaqnfeavaqyqfdfglrpsvaylqskgknlgvvagrnydde
dilkyvdvgatyyfnknmstyvdykinllddnqftraagintddivalglvyqf

Timeline for d2ixxa_:

• d2ixxa_ first appeared in SCOPe 2.06
  
• d2ixxa_ appears in SCOPe 2.07