Lineage for d2ixxa_ (2ixx A:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2575768Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2575889Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 2575890Family f.4.3.1: Porin [56936] (2 proteins)
    trimer, one subunit folds into (16,20) barrel
  6. 2575961Protein automated matches [190289] (6 species)
    not a true protein
  7. 2575972Species Escherichia coli [TaxId:562] [187889] (8 PDB entries)
  8. 2575983Domain d2ixxa_: 2ixx A: [304085]
    automated match to d2xe1a_
    complexed with mha

Details for d2ixxa_

PDB Entry: 2ixx (more details), 2.5 Å

PDB Description: structural basis for ompc mediated antibiotic resistance in clinical isolates of escherichia coli.
PDB Compounds: (A:) Outer membrane protein C

SCOPe Domain Sequences for d2ixxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ixxa_ f.4.3.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
aevynkdgnkldlygkvdglhyfsddksvdgdqtymrlgfkgetqvtdqltgygqweyqi
qgnapesennswtrvafaglkfqdigsfdygrnygvvydvtswtdvlpefggdtygsdnf
mqqrgngfatyrntdffglvdglnfavqyqgqngsvsgendpdftghgitnngrkalrqn
gdgvggsitydyegfgvgaavssskrtwdqnntgligtgdraetytgglkydanniylaa
qytqtynatrvgslgwankaqnfeavaqyqfdfglrpsvaylqskgknlgvvagrnydde
dilkyvdvgatyyfnknmstyvdykinllddnqftraagintddivalglvyqf

SCOPe Domain Coordinates for d2ixxa_:

Click to download the PDB-style file with coordinates for d2ixxa_.
(The format of our PDB-style files is described here.)

Timeline for d2ixxa_: