Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.4.3: Porins [56935] (5 families) |
Family f.4.3.1: Porin [56936] (2 proteins) trimer, one subunit folds into (16,20) barrel |
Protein automated matches [190289] (7 species) not a true protein |
Species Escherichia coli [TaxId:562] [187889] (9 PDB entries) |
Domain d2ixwb_: 2ixw B: [304083] automated match to d2xe3a_ complexed with oes |
PDB Entry: 2ixw (more details), 2.7 Å
SCOPe Domain Sequences for d2ixwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ixwb_ f.4.3.1 (B:) automated matches {Escherichia coli [TaxId: 562]} aeiynkdgnkldlygkvdglhyfsdndskdgdktymrlgfkgetqvtdqltgygqweyqi qgnepesdnsswtrvafaglkfqdvgsfdygrnygvvydvtswtdvlpefggdtydsdnf mqqrgngfatyrntdffglvdgldfavqyqgkngsahgegmttngrddvfeqngdgvggs itynyegfgigaavssskrtwdqnntgligtgdraetytgglkydanniylaaqytqtyn atrvgslgwankaqnfeavaqyqfdfglrpslaylqskgknlgrgyddedilkyvdvgat yyfnknmstyvdykinllddnrftrdagintddivalglvyqf
Timeline for d2ixwb_: