SCOPe 2.06: Domain d2ihyb1: 2ihy B:1-259

Lineage for d2ihyb1 (2ihy B:1-259)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [187532] (5 PDB entries)

8. Domain d2ihyb1: 2ihy B:1-259 [304066]
   Other proteins in same PDB: d2ihya2, d2ihyb2
   automated match to d4hzia_
   complexed with so4

Details for d2ihyb1

PDB Entry: 2ihy, 1.9 Å

PDB Description: Structure of the Staphylococcus aureus putative ATPase subunit of an ATP-binding cassette (ABC) transporter

PDB Compounds: (B:) ABC transporter, ATP-binding protein

SCOPe Domain Sequences for d2ihyb1:

Sequence; same for both SEQRES and ATOM records:

>d2ihyb1 c.37.1.0 (B:1-259) automated matches {Staphylococcus aureus [TaxId: 1280]}
mliqldqigrmkqgktilkkiswqiakgdkwilyglngagkttllnilnayepatsgtvn
lfgkmpgkvgysaetvrqhigfvshsllekfqegervidvvisgafksigvyqdiddeir
neahqllklvgmsakaqqyigylstgekqrvmiaralmgqpqvlildepaagldfiares
llsildslsdsyptlamiyvthfieeitanfskilllkdgqsiqqgavediltsenmsrf
fqknvavqrwnnrfsmaml

Timeline for d2ihyb1:

• d2ihyb1 is new in SCOPe 2.06-stable
  
• d2ihyb1 appears in SCOPe 2.07
  
• d2ihyb1 appears in the current release, SCOPe 2.08