SCOPe 2.08: Domain d2hv0b_: 2hv0 B:

Lineage for d2hv0b_ (2hv0 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (49 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225745] (65 PDB entries)

8. Domain d2hv0b_: 2hv0 B: [304035]
   automated match to d3cxpa_
   complexed with 16g, coa

Details for d2hv0b_

PDB Entry: 2hv0, 1.8 Å

PDB Description: Crystal structure of GNPNAT1

PDB Compounds: (B:) Glucosamine 6-phosphate N-acetyltransferase

SCOPe Domain Sequences for d2hv0b_:

Sequence; same for both SEQRES and ATOM records:

>d2hv0b_ d.108.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pdetpmfdpsllkevdwsqntatfspaispthpgeglvlrplctadlnrgffkvlgqlte
tgvvspeqfmksfehmkksgdyyvtvvedvtlgqivatatliiehkfihscakrgrvedv
vvsdecrgkqlgklllstltllskklncykitleclpqnvgfykkfgytvseenymcrrf

Timeline for d2hv0b_:

• d2hv0b_ first appeared in SCOPe 2.06
  
• d2hv0b_ appears in SCOPe 2.07