Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) duplication: consists of 3 similar intertwined domains structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta |
Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) |
Family d.130.1.1: S-adenosylmethionine synthetase [55974] (2 proteins) |
Protein S-adenosylmethionine synthetase [55975] (3 species) synonym: methionine adenosyltransferase, MAT |
Species Human (Homo sapiens), isoform type-2 [TaxId:9606] [160759] (8 PDB entries) Uniprot P31153 126-251! Uniprot P31153 16-125! Uniprot P31153 252-395 MAT2A |
Domain d2hj2b2: 2hj2 B:126-251 [304015] automated match to d2p02a2 complexed with cl, sam |
PDB Entry: 2hj2 (more details), 1.03 Å
SCOPe Domain Sequences for d2hj2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hj2b2 d.130.1.1 (B:126-251) S-adenosylmethionine synthetase {Human (Homo sapiens), isoform type-2 [TaxId: 9606]} needigagdqglmfgyatdeteecmpltivlahklnaklaelrrngtlpwlrpdsktqvt vqymqdrgavlpirvhtivisvqhdeevcldemrdalkekvikavvpakyldedtiyhlq psgrfv
Timeline for d2hj2b2: