Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.23: Probable ACP-binding domain of malonyl-CoA ACP transacylase [55048] (1 family) |
Family d.58.23.1: Probable ACP-binding domain of malonyl-CoA ACP transacylase [55049] (2 proteins) |
Protein Ferredoxin-like domain from acyl transferase (AT) domain of 6-deoxyerythronolide B synthase (DEBS) [310771] (1 species) |
Species Saccharopolyspora erythraea [TaxId:1836] [311027] (1 PDB entry) |
Domain d2hg4e5: 2hg4 E:678-741 [304001] Other proteins in same PDB: d2hg4a1, d2hg4a2, d2hg4a3, d2hg4a4, d2hg4a6, d2hg4a7, d2hg4b1, d2hg4b2, d2hg4b3, d2hg4b4, d2hg4b6, d2hg4b7, d2hg4c1, d2hg4c2, d2hg4c3, d2hg4c4, d2hg4c6, d2hg4c7, d2hg4d1, d2hg4d2, d2hg4d3, d2hg4d4, d2hg4d6, d2hg4d7, d2hg4e1, d2hg4e2, d2hg4e3, d2hg4e4, d2hg4e6, d2hg4e7, d2hg4f1, d2hg4f2, d2hg4f3, d2hg4f4, d2hg4f6, d2hg4f7 complexed with act, cl, so4 |
PDB Entry: 2hg4 (more details), 2.73 Å
SCOPe Domain Sequences for d2hg4e5:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hg4e5 d.58.23.1 (E:678-741) Ferredoxin-like domain from acyl transferase (AT) domain of 6-deoxyerythronolide B synthase (DEBS) {Saccharopolyspora erythraea [TaxId: 1836]} ggmasfglgteqaaerigrfagalsiasvngprsvvvagesgpldeliaeceaeahkarr ipvd
Timeline for d2hg4e5:
View in 3D Domains from other chains: (mouse over for more information) d2hg4a1, d2hg4a2, d2hg4a3, d2hg4a4, d2hg4a5, d2hg4a6, d2hg4a7, d2hg4b1, d2hg4b2, d2hg4b3, d2hg4b4, d2hg4b5, d2hg4b6, d2hg4b7, d2hg4c1, d2hg4c2, d2hg4c3, d2hg4c4, d2hg4c5, d2hg4c6, d2hg4c7, d2hg4d1, d2hg4d2, d2hg4d3, d2hg4d4, d2hg4d5, d2hg4d6, d2hg4d7, d2hg4f1, d2hg4f2, d2hg4f3, d2hg4f4, d2hg4f5, d2hg4f6, d2hg4f7 |