Lineage for d2hg4c5 (2hg4 C:678-741)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2197489Superfamily d.58.23: Probable ACP-binding domain of malonyl-CoA ACP transacylase [55048] (1 family) (S)
  5. 2197490Family d.58.23.1: Probable ACP-binding domain of malonyl-CoA ACP transacylase [55049] (2 proteins)
  6. 2197491Protein Ferredoxin-like domain from acyl transferase (AT) domain of 6-deoxyerythronolide B synthase (DEBS) [310771] (1 species)
  7. 2197492Species Saccharopolyspora erythraea [TaxId:1836] [311027] (1 PDB entry)
  8. 2197495Domain d2hg4c5: 2hg4 C:678-741 [303987]
    Other proteins in same PDB: d2hg4a1, d2hg4a2, d2hg4a3, d2hg4a4, d2hg4a6, d2hg4a7, d2hg4b1, d2hg4b2, d2hg4b3, d2hg4b4, d2hg4b6, d2hg4b7, d2hg4c1, d2hg4c2, d2hg4c3, d2hg4c4, d2hg4c6, d2hg4c7, d2hg4d1, d2hg4d2, d2hg4d3, d2hg4d4, d2hg4d6, d2hg4d7, d2hg4e1, d2hg4e2, d2hg4e3, d2hg4e4, d2hg4e6, d2hg4e7, d2hg4f1, d2hg4f2, d2hg4f3, d2hg4f4, d2hg4f6, d2hg4f7
    complexed with act, cl, so4

Details for d2hg4c5

PDB Entry: 2hg4 (more details), 2.73 Å

PDB Description: Structure of the ketosynthase-acyltransferase didomain of module 5 from DEBS.
PDB Compounds: (C:) 6-Deoxyerythronolide B Synthase

SCOPe Domain Sequences for d2hg4c5:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hg4c5 d.58.23.1 (C:678-741) Ferredoxin-like domain from acyl transferase (AT) domain of 6-deoxyerythronolide B synthase (DEBS) {Saccharopolyspora erythraea [TaxId: 1836]}
ggmasfglgteqaaerigrfagalsiasvngprsvvvagesgpldeliaeceaeahkarr
ipvd

SCOPe Domain Coordinates for d2hg4c5:

Click to download the PDB-style file with coordinates for d2hg4c5.
(The format of our PDB-style files is described here.)

Timeline for d2hg4c5: