Lineage for d2hakf_ (2hak F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2984752Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2984753Protein automated matches [190417] (37 species)
    not a true protein
  7. 2984910Species Human (Homo sapiens) [TaxId:9606] [187294] (1476 PDB entries)
  8. 2986917Domain d2hakf_: 2hak F: [303959]
    automated match to d2wzjd_

Details for d2hakf_

PDB Entry: 2hak (more details), 2.6 Å

PDB Description: catalytic and ubiqutin-associated domains of mark1/par-1
PDB Compounds: (F:) Serine/threonine-protein kinase MARK1

SCOPe Domain Sequences for d2hakf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hakf_ d.144.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qphignyrlqktigkgnfakvklarhvltgrevavkiidktqlnptslqklfrevrimki
lnhpnivklfevietektlylvmeyasggevfdylvahgrmkekearakfrqivsavqyc
hqkyivhrdlkaenllldgdmnikiadfgfsneftvgnkldtfcgsppyaapelfqgkky
dgpevdvwslgvilytlvsgslpfdgqnlkelrervlrgkyripfymstdcenllkkllv
lnpikrgsleqimkdrwmnvgheeeelkpytepdpdfndtkridimvtmgfardeindal
inqkydevmatyillgrk

SCOPe Domain Coordinates for d2hakf_:

Click to download the PDB-style file with coordinates for d2hakf_.
(The format of our PDB-style files is described here.)

Timeline for d2hakf_: