Lineage for d2fnza4 (2fnz A:165-333)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2998748Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2998755Protein Lactate dehydrogenase [56339] (20 species)
  7. 2998790Species Cryptosporidium parvum [TaxId:5807] [225186] (10 PDB entries)
  8. 2998813Domain d2fnza4: 2fnz A:165-333 [303875]
    Other proteins in same PDB: d2fnza3, d2fnzb3
    automated match to d4nd1a2
    complexed with gol, nad, oxm, so4

Details for d2fnza4

PDB Entry: 2fnz (more details), 2.5 Å

PDB Description: Crystal structure of the lactate dehydrogenase from cryptosporidium parvum complexed with cofactor (b-nicotinamide adenine dinucleotide) and inhibitor (oxamic acid)
PDB Compounds: (A:) lactate dehydrogenase

SCOPe Domain Sequences for d2fnza4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fnza4 d.162.1.1 (A:165-333) Lactate dehydrogenase {Cryptosporidium parvum [TaxId: 5807]}
gvldssrfrtfiaqhfgvnasdvsanvigghgdgmvpatssvsvggvplssfikqglitq
eqideivchtriawkevadnlktgtayfapaaaavkmaeaylkdkkavvpcsafcsnhyg
vkgiymgvptiigkngvedileldltpleqkllgesinevntiskvldnap

SCOPe Domain Coordinates for d2fnza4:

Click to download the PDB-style file with coordinates for d2fnza4.
(The format of our PDB-style files is described here.)

Timeline for d2fnza4:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fnza3