Lineage for d2fnyv_ (2fny V:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2552691Protein automated matches [190144] (11 species)
    not a true protein
  7. 2552960Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (197 PDB entries)
  8. 2553257Domain d2fnyv_: 2fny V: [303869]
    Other proteins in same PDB: d2fny1_, d2fny2_, d2fnya_, d2fnyb_, d2fnyc_, d2fnye_, d2fnyf_, d2fnyi_, d2fnyj_, d2fnyk_, d2fnyl_, d2fnym_, d2fnyn_, d2fnyo_, d2fnyp_, d2fnyq_, d2fnys_, d2fnyt_, d2fnyw_, d2fnyx_, d2fnyy_, d2fnyz_
    automated match to d4r17h_
    complexed with esy

Details for d2fnyv_

PDB Entry: 2fny (more details), 3 Å

PDB Description: Homobelactosin C bound to the yeast 20S proteasome
PDB Compounds: (V:) Proteasome component PUP1

SCOPe Domain Sequences for d2fnyv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fnyv_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd

SCOPe Domain Coordinates for d2fnyv_:

Click to download the PDB-style file with coordinates for d2fnyv_.
(The format of our PDB-style files is described here.)

Timeline for d2fnyv_: