SCOPe 2.08: Domain d2fnyl_: 2fny L:

Lineage for d2fnyl_ (2fny L:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
   contains an extension to the common fold at the N-terminus

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (240 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d2fnyl_: 2fny L: [303860]
   Other proteins in same PDB: d2fnyg_, d2fnyh_, d2fnyu_, d2fnyv_
   automated match to d4j70l_
   complexed with esy

Details for d2fnyl_

PDB Entry: 2fny, 3 Å

PDB Description: Homobelactosin C bound to the yeast 20S proteasome

PDB Compounds: (L:) Proteasome component C5

SCOPe Domain Sequences for d2fnyl_:

Sequence; same for both SEQRES and ATOM records:

>d2fnyl_ d.153.1.4 (L:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd

Timeline for d2fnyl_:

• d2fnyl_ first appeared in SCOPe 2.06
  
• d2fnyl_ appears in SCOPe 2.07