SCOPe 2.06: Domain d2fe8b2: 2fe8 B:63-314

Lineage for d2fe8b2 (2fe8 B:63-314)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins)
   C-terminal part of Pfam PF08715

6. Protein Papain-like protease PLpro, catalytic domain [310795] (3 species)

7. Species SARS coronavirus [TaxId:227859] [311054] (1 PDB entry)

8. Domain d2fe8b2: 2fe8 B:63-314 [303818]
   Other proteins in same PDB: d2fe8a1, d2fe8b1, d2fe8c1
   complexed with br, so4, zn

Details for d2fe8b2

PDB Entry: 2fe8, 1.85 Å

PDB Description: sars coronavirus papain-like protease: structure of a viral deubiquitinating enzyme

PDB Compounds: (B:) Replicase polyprotein 1ab

SCOPe Domain Sequences for d2fe8b2:

Sequence; same for both SEQRES and ATOM records:

>d2fe8b2 d.3.1.23 (B:63-314) Papain-like protease PLpro, catalytic domain {SARS coronavirus [TaxId: 227859]}
dtlrseafeyyhtldesflgrymsalnhtkkwkfpqvggltsikwadnncylssvllalq
qlevkfnapalqeayyraragdaanfcalilaysnktvgelgdvretmthllqhanlesa
krvlnvvckhcgqktttltgveavmymgtlsydnlktgvsipcvcgrdatqylvqqessf
vmmsappaeyklqqgtflcaneytgnyqcghythitaketlyridgahltkmseykgpvt
dvfyketsyttt

Timeline for d2fe8b2:

• d2fe8b2 is new in SCOPe 2.06-stable
  
• d2fe8b2 appears in SCOPe 2.07
  
• d2fe8b2 appears in the current release, SCOPe 2.08