Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.9: Viral protease ubiquitin-like domain [310647] (1 protein) N-terminal part of Pfam PF08715 |
Protein Papain-like protease PLpro, ubiquitin-like domain [310794] (2 species) |
Species SARS coronavirus [TaxId:227859] [311052] (1 PDB entry) |
Domain d2fe8b1: 2fe8 B:1-62 [303817] Other proteins in same PDB: d2fe8a2, d2fe8b2, d2fe8c2 complexed with br, so4, zn |
PDB Entry: 2fe8 (more details), 1.85 Å
SCOPe Domain Sequences for d2fe8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fe8b1 d.15.1.9 (B:1-62) Papain-like protease PLpro, ubiquitin-like domain {SARS coronavirus [TaxId: 227859]} mevktikvfttvdntnlhtqlvdmsmtygqqfgptyldgadvtkikphvnhegktffvlp sd
Timeline for d2fe8b1:
View in 3D Domains from other chains: (mouse over for more information) d2fe8a1, d2fe8a2, d2fe8c1, d2fe8c2 |