SCOPe 2.08: Domain d2fe8b1: 2fe8 B:1-62

Lineage for d2fe8b1 (2fe8 B:1-62)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.9: Viral protease ubiquitin-like domain [310647] (1 protein)
   N-terminal part of Pfam PF08715

6. Protein Papain-like protease PLpro, ubiquitin-like domain [310794] (2 species)

7. Species SARS coronavirus [TaxId:227859] [311052] (1 PDB entry)

8. Domain d2fe8b1: 2fe8 B:1-62 [303817]
   Other proteins in same PDB: d2fe8a2, d2fe8b2, d2fe8c2
   complexed with br, so4, zn

Details for d2fe8b1

PDB Entry: 2fe8, 1.85 Å

PDB Description: sars coronavirus papain-like protease: structure of a viral deubiquitinating enzyme

PDB Compounds: (B:) Replicase polyprotein 1ab

SCOPe Domain Sequences for d2fe8b1:

Sequence; same for both SEQRES and ATOM records:

>d2fe8b1 d.15.1.9 (B:1-62) Papain-like protease PLpro, ubiquitin-like domain {SARS coronavirus [TaxId: 227859]}
mevktikvfttvdntnlhtqlvdmsmtygqqfgptyldgadvtkikphvnhegktffvlp
sd

Timeline for d2fe8b1:

• d2fe8b1 first appeared in SCOPe 2.06
  
• d2fe8b1 appears in SCOPe 2.07