Lineage for d1b3mb1 (1b3m B:1-217,B:322-385)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 119015Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 119016Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 119045Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (8 proteins)
  6. 119147Protein Sarcosine oxidase [51920] (1 species)
  7. 119148Species Bacillus sp., strain b0618 [TaxId:1409] [51921] (6 PDB entries)
  8. 119156Domain d1b3mb1: 1b3m B:1-217,B:322-385 [30380]
    Other proteins in same PDB: d1b3ma2, d1b3mb2

Details for d1b3mb1

PDB Entry: 1b3m (more details), 2 Å

PDB Description: monomeric sarcosine oxidase from bacillus sp. b-0618

SCOP Domain Sequences for d1b3mb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b3mb1 c.3.1.2 (B:1-217,B:322-385) Sarcosine oxidase {Bacillus sp., strain b0618}
sthfdvivvgagsmgmaagyqlakqgvktllvdafdpphtngshhgdtriirhaygegre
yvplalrsqelwyelekethhkiftktgvlvfgpkgesafvaetmeaakehsltvdlleg
deinkrwpgitvpenynaifepnsgvlfsencirayrelaeargakvlthtrvedfdisp
dsvkietangsytadklivsmgawnskllsklnldipXdehfiidlhpehsnvviaagfs
ghgfkfssgvgevlsqlaltgktehdisifsinrpalkeslq

SCOP Domain Coordinates for d1b3mb1:

Click to download the PDB-style file with coordinates for d1b3mb1.
(The format of our PDB-style files is described here.)

Timeline for d1b3mb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b3mb2