Lineage for d2edea1 (2ede A:8-108)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2762239Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 2762240Protein automated matches [190976] (5 species)
    not a true protein
  7. 2762264Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries)
  8. 2762400Domain d2edea1: 2ede A:8-108 [303759]
    Other proteins in same PDB: d2edea2, d2edea3
    automated match to d2dm4a_

Details for d2edea1

PDB Entry: 2ede (more details)

PDB Description: solution structure of the sixth fibronectin type iii domain of human netrin receptor dcc
PDB Compounds: (A:) Netrin receptor DCC

SCOPe Domain Sequences for d2edea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2edea1 b.1.2.0 (A:8-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ptsapkdltvitregkpravivswqppleangkitayilfytldknipiddwimetisgd
rlthqimdlnldtmyyfriqarnskgvgplsdpilfrtlkv

SCOPe Domain Coordinates for d2edea1:

Click to download the PDB-style file with coordinates for d2edea1.
(The format of our PDB-style files is described here.)

Timeline for d2edea1: