SCOPe 2.06: Domain d2dtqa3: 2dtq A:234-339

Lineage for d2dtqa3 (2dtq A:234-339)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88585] (57 PDB entries)
   Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region

8. Domain d2dtqa3: 2dtq A:234-339 [303739]
   Other proteins in same PDB: d2dtqa4, d2dtqb4
   automated match to d1hzhh3
   complexed with nag

Details for d2dtqa3

PDB Entry: 2dtq, 2 Å

PDB Description: Crystal Structure of the Fucosylated Fc Fragment from Human Immunoglobulin G1

PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d2dtqa3:

Sequence; same for both SEQRES and ATOM records:

>d2dtqa3 b.1.1.2 (A:234-339) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
llggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpre
eqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

Timeline for d2dtqa3:

• d2dtqa3 is new in SCOPe 2.06-stable
  
• d2dtqa3 appears in SCOPe 2.07
  
• d2dtqa3 appears in the current release, SCOPe 2.08