Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (51 species) not a true protein |
Species Micromonospora viridifaciens [TaxId:1881] [254943] (4 PDB entries) |
Domain d2bq9b3: 2bq9 B:506-647 [303610] Other proteins in same PDB: d2bq9a1, d2bq9a2, d2bq9b1, d2bq9b2, d2bq9c1, d2bq9c2 automated match to d1w8oa2 complexed with gal, gol, na |
PDB Entry: 2bq9 (more details), 2 Å
SCOPe Domain Sequences for d2bq9b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bq9b3 b.18.1.0 (B:506-647) automated matches {Micromonospora viridifaciens [TaxId: 1881]} qarmsiadvdseetaredgrasnvidgnpstfwhtewsradapgyphrisldlggthtis glqytrrqnsaneqvadyeiytslngttwdgpvasgrfttslapqravfpardaryirlv alseqtghkyaavaelevegqr
Timeline for d2bq9b3: