SCOPe 2.08: Domain d2ao8a2: 2ao8 A:240-307

Lineage for d2ao8a2 (2ao8 A:240-307)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)

6. Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
   secreted during involution

7. Species Sheep (Ovis aries) [TaxId:9940] [109621] (17 PDB entries)
   Uniprot Q6TMG6

8. Domain d2ao8a2: 2ao8 A:240-307 [303519]
   Other proteins in same PDB: d2ao8a1
   automated match to d1sr0a2

Details for d2ao8a2

PDB Entry: 2ao8, 2.2 Å

PDB Description: Binding of chitin-like polysaccharide to protective signalling factor: Crystal structure of the complex formed between signalling protein from sheep (SPS-40) with a tetrasaccharide at 2.2 A resolution

PDB Compounds: (A:) Signal Processing Protein, SPS-40

SCOPe Domain Sequences for d2ao8a2:

Sequence; same for both SEQRES and ATOM records:

>d2ao8a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]}
fgrsftlassktdvgapvsgpgvpgrftkekgilayyeicdflhgatthrfrdqqvpyat
kgnqwvay

Timeline for d2ao8a2:

• d2ao8a2 first appeared in SCOPe 2.06
  
• d2ao8a2 appears in SCOPe 2.07