SCOPe 2.08: Domain d1ypdb3: 1ypd B:361-556

Lineage for d1ypdb3 (1ypd B:361-556)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.0: automated matches [227300] (1 protein)
   not a true family

6. Protein automated matches [227126] (21 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255615] (5 PDB entries)

8. Domain d1ypdb3: 1ypd B:361-556 [303409]
   Other proteins in same PDB: d1ypda2, d1ypdb2
   automated match to d2vk1a3
   complexed with mg, tpp

Details for d1ypdb3

PDB Entry: 1ypd, 2.4 Å

PDB Description: thdp dependent pyruvate decarboyxlase from yeast (form b)

PDB Compounds: (B:) pyruvate decarboxylase (form b)

SCOPe Domain Sequences for d1ypdb3:

Sequence; same for both SEQRES and ATOM records:

>d1ypdb3 c.36.1.0 (B:361-556) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
astplkqewmwnqlgnflqegdvviaetgtsafginqttfpnntygisqvlwgsigfttg
atlgaafaaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytiekli
hgpkaqyneiqgwdhlsllptfgakdyethrvattgewdkltqdksfndnskirmieiml
pvfdapqnlveqaklt

Timeline for d1ypdb3:

• d1ypdb3 first appeared in SCOPe 2.06
  
• d1ypdb3 appears in SCOPe 2.07