Lineage for d1b8sa1 (1b8s A:9-318,A:451-506)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 822279Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 822280Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) (S)
  5. 822334Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 822335Protein Cholesterol oxidase of GMC family [51914] (3 species)
  7. 822341Species Streptomyces sp. [TaxId:1931] [51916] (13 PDB entries)
  8. 822352Domain d1b8sa1: 1b8s A:9-318,A:451-506 [30335]
    Other proteins in same PDB: d1b8sa2
    complexed with fad; mutant

Details for d1b8sa1

PDB Entry: 1b8s (more details), 1.65 Å

PDB Description: cholesterol oxidase from streptomyces glu361gln mutant
PDB Compounds: (A:) protein (cholesterol oxidase)

SCOP Domain Sequences for d1b8sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b8sa1 c.3.1.2 (A:9-318,A:451-506) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]}
gyvpavvigtgygaavsalrlgeagvqtlmlemgqlwnqpgpdgnifcgmlnpdkrsswf
knrteaplgsflwldvvnrnidpyagvldrvnydqmsvyvgrgvgggslvnggmavepkr
syfeeilprvdssemydryfpransmlrvnhidtkwfedtewykfarvsreqagkaglgt
vfvpnvydfgymqreaagevpksalateviygnnhgkqsldktylaaalgtgkvtiqtlh
qvktirqtkdggyaltveqkdtdgkllatkeiscrylflgagslgstellvrardtgtlp
nlnsevgagwXgcvlgkatddygrvagyknlyvtdgslipgsvgvnpfvtitalaernve
riikqdv

SCOP Domain Coordinates for d1b8sa1:

Click to download the PDB-style file with coordinates for d1b8sa1.
(The format of our PDB-style files is described here.)

Timeline for d1b8sa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b8sa2