Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily) contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain |
Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) |
Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins) |
Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) [68925] (4 species) |
Species Thermus thermophilus [TaxId:274] [82555] (4 PDB entries) Uniprot Q7SIC6 |
Domain d1wg9b3: 1wg9 B:1-211 [303294] Other proteins in same PDB: d1wg9b4 automated match to d1j3ba2 complexed with atp, ca, gol, po4 |
PDB Entry: 1wg9 (more details), 2.2 Å
SCOPe Domain Sequences for d1wg9b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wg9b3 c.109.1.1 (B:1-211) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} mqrlealgihpkkrvfwntvspvlvehtllrgegllahhgplvvdttpytgrspkdkfvv repevegeiwwgevnqpfapeafealyqrvvqylserdlyvqdlyagadrryrlavrvvt espwhalfarnmfilprrfgnddeveafvpgftvvhapyfqavperdgtrsevfvgisfq rrlvlivgtkyageikksiftvmnylmpkrg
Timeline for d1wg9b3: