Lineage for d1wb2b5 (1wb2 B:180-271)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2792984Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2793298Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 2793299Protein automated matches [226946] (29 species)
    not a true protein
  7. 2793368Species Methanococcus maripaludis [TaxId:39152] [311184] (2 PDB entries)
  8. 2793377Domain d1wb2b5: 1wb2 B:180-271 [303283]
    Other proteins in same PDB: d1wb2a5, d1wb2a7, d1wb2a9, d1wb2b4, d1wb2b6, d1wb2c5, d1wb2c7, d1wb2c9, d1wb2d4, d1wb2d6
    automated match to d4ac9a1
    complexed with dxc, so4

Details for d1wb2b5

PDB Entry: 1wb2 (more details), 3.1 Å

PDB Description: Crystal structure of translation elongation factor SelB from Methanococcus maripaludis, apo form
PDB Compounds: (B:) translation elongation factor selb

SCOPe Domain Sequences for d1wb2b5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wb2b5 b.43.3.0 (B:180-271) automated matches {Methanococcus maripaludis [TaxId: 39152]}
rntesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinmstkvrsiqyfkesv
meakagdrvgmaiqgvdakqiyrgciltskdt

SCOPe Domain Coordinates for d1wb2b5:

Click to download the PDB-style file with coordinates for d1wb2b5.
(The format of our PDB-style files is described here.)

Timeline for d1wb2b5: