Lineage for d1wb1d4 (1wb1 D:5-179)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872500Species Methanococcus maripaludis [TaxId:39152] [226757] (5 PDB entries)
  8. 2872507Domain d1wb1d4: 1wb1 D:5-179 [303274]
    Other proteins in same PDB: d1wb1a6, d1wb1a7, d1wb1a8, d1wb1a9, d1wb1b5, d1wb1b6, d1wb1c6, d1wb1c7, d1wb1c8, d1wb1c9, d1wb1d5, d1wb1d6
    automated match to d4ac9a4
    complexed with dxc, gdp, mg, so4

Details for d1wb1d4

PDB Entry: 1wb1 (more details), 3 Å

PDB Description: Crystal structure of translation elongation factor SelB from Methanococcus maripaludis in complex with GDP
PDB Compounds: (D:) translation elongation factor selb

SCOPe Domain Sequences for d1wb1d4:

Sequence, based on SEQRES records: (download)

>d1wb1d4 c.37.1.0 (D:5-179) automated matches {Methanococcus maripaludis [TaxId: 39152]}
ninlgifghidhgkttlskvlteiastsahdklpesqkrgitidigfsafklenyritlv
dapghadliravvsaadiidlalivvdakegpktqtgehmlildhfnipiivvitksdna
gteeikrtemimksilqsthnlknssiipisaktgfgvdelknliittlnnaeii

Sequence, based on observed residues (ATOM records): (download)

>d1wb1d4 c.37.1.0 (D:5-179) automated matches {Methanococcus maripaludis [TaxId: 39152]}
ninlgifghidhgkttlskvlteiastfsafklenyritlvddliravvsaadiidlali
vvdakegpktqtgehmlildhfnipiivvitksdnagteeikrtemimksilqsthnlkn
ssiipisaktgfgvdelknliittlnnaeii

SCOPe Domain Coordinates for d1wb1d4:

Click to download the PDB-style file with coordinates for d1wb1d4.
(The format of our PDB-style files is described here.)

Timeline for d1wb1d4: